Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Recombinant Mouse Antibody Fab Fragment is directed against Human C5AR1, expressed in Chinese Hamster Ovary cells(CHO)
Target
C5AR1
Type
Fab
Immunogen
Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, corresponding to N terminal amino acids 1-31 of Human C5R1MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
Species Reactivity
Human
Expression Host
CHO
Applications
Suitable for use in FC, IP, ELISA, Neut, FuncS, IF and most other immunological methods.
Specific Activity
Tested positive against native antigen.
Purity
>95.0% as determined by Analysis by RP-HPLC & analysis by SDS-PAGE.
Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to pack the protein into smaller quantities for optimal storage.
BACKGROUND
Antigen Description
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.